PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678320491
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family TALE
Protein Properties Length: 402aa    MW: 45279.5 Da    PI: 6.7249
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678320491genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox283.7e-093283632055
                HHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
   Homeobox  20 eknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                +k +yps++e+  LA+ +gL+++q+ +WF N+R ++
  678320491 328 YKWPYPSESEKVALAEATGLDQKQINNWFINQRKRH 363
                4679*****************************885 PP

2ELK38.42.7e-13283304122
        ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                ELK++LlrKYsgyL+sL+qE+s
  678320491 283 ELKNHLLRKYSGYLSSLRQELS 304
                9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012553.2E-20114158IPR005540KNOX1
PfamPF037901.7E-21115156IPR005540KNOX1
SMARTSM012564.8E-25166239IPR005541KNOX2
PfamPF037911.2E-14203238IPR005541KNOX2
SMARTSM011882.0E-7283304IPR005539ELK domain
PROSITE profilePS5121311.488283303IPR005539ELK domain
PfamPF037891.3E-10283304IPR005539ELK domain
PROSITE profilePS5007113.021303366IPR001356Homeobox domain
SuperFamilySSF466895.99E-20304380IPR009057Homeodomain-like
SMARTSM003893.4E-13305370IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.6E-27308369IPR009057Homeodomain-like
CDDcd000861.27E-12315367No hitNo description
PfamPF059201.3E-16323362IPR008422Homeobox KN domain
PROSITE patternPS000270341364IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001708Biological Processcell fate specification
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010089Biological Processxylem development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 402 aa     Download sequence    Send to blast
MEGYTHPSHL TENVNNNNSD NNNYSRAGFV YTAGGGPVVA PSSSSLPFQG RVSPGSGGDH  60
LHQLEFGGLG VCFDQSQHHT VITEPGFSYN NNTDKFHYAA SSAQRQPVEL FQADAVKAKI  120
VAHPQYSNLL EAYMDCHKVG APPEVVARLA QVRQDFEAWH RGANRDSDGN SKDPELDQFM  180
VVIIGNSSSK IKLAPICLLR YQEAYYDMLV KYREELTRPL QEAMEFMRRV ETQLSMLTTA  240
PTRGFNSDDN SVGGGSSDDD QENSVGVEAG GVPGIDPRAE DRELKNHLLR KYSGYLSSLR  300
QELSKKKKKG KLPKEARQKL LSWWELHYKW PYPSESEKVA LAEATGLDQK QINNWFINQR  360
KRHWKPSEDM QFMVMDGFHH PQNPTLYMDG HYLGEGPYRL AP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00675ChIP-seqTransfer from GRMZM2G017087Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011074319.11e-152PREDICTED: homeotic protein knotted-1
SwissprotQ413301e-137KN1_SOLLC; Homeotic protein knotted-1
TrEMBLA0A067KZF31e-147A0A067KZF3_JATCU; Uncharacterized protein
STRINGVIT_18s0001g08380.t011e-144(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA49732333
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.11e-119KNOTTED-like from Arabidopsis thaliana